PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7DS_8DF2537B8.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 109aa    MW: 12693.7 Da    PI: 11.6853
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7DS_8DF2537B8.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.43.8e-091321748
                           HHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding 17 kqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +q+G g+W+++ r  g+ R++k+c++rw ++l
  Traes_7DS_8DF2537B8.1  1 RQHGEGNWNAVQRITGLLRCGKSCRLRWTNHL 32
                           59**************99***********996 PP

2Myb_DNA-binding53.17.1e-173881146
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                           +g+++++E++l +++++qlG++ W++ a +++ gRt++++k++w++
  Traes_7DS_8DF2537B8.1 38 KGAFSPDEELLVAQLHAQLGNK-WARMATHLP-GRTDNEIKNYWNT 81
                           799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF002498.7E-7132IPR001005SANT/Myb domain
PROSITE profilePS512949.042132IPR017930Myb domain
CDDcd001671.18E-4132No hitNo description
SMARTSM0071732134IPR001005SANT/Myb domain
SuperFamilySSF466894.3E-21279IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-13238IPR009057Homeodomain-like
PROSITE profilePS5129423.3663387IPR017930Myb domain
SMARTSM007179.1E-143785IPR001005SANT/Myb domain
PfamPF002491.1E-153881IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-243986IPR009057Homeodomain-like
CDDcd001675.89E-104081No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 109 aa     Download sequence    Send to blast
RQHGEGNWNA VQRITGLLRC GKSCRLRWTN HLRPNLKKGA FSPDEELLVA QLHAQLGNKW  60
ARMATHLPGR TDNEIKNYWN TRAKRRQRAG LPMYPPEVQL QLAITKRCR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A9e-2118620104MYB PROTO-ONCOGENE PROTEIN
1mse_C9e-2118620104C-Myb DNA-Binding Domain
1msf_C9e-2118620104C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0425371e-100BT042537.1 Zea mays full-length cDNA clone ZM_BFb0325G13 mRNA, complete cds.
GenBankKJ7275321e-100KJ727532.1 Zea mays clone pUT5392 MYB transcription factor (MYB129) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002466889.18e-71hypothetical protein SORBIDRAFT_01g015920
RefseqXP_006650271.11e-69PREDICTED: myb-related protein P-like
SwissprotA2WW872e-55GAM1_ORYSI; Transcription factor GAMYB
SwissprotQ0JIC22e-55GAM1_ORYSJ; Transcription factor GAMYB
TrEMBLM7YE113e-75M7YE11_TRIUA; Transcription factor GAMYB
TrEMBLM8C0602e-75M8C060_AEGTA; Transcription factor GAMYB
TrEMBLW5I9131e-76W5I913_WHEAT; Uncharacterized protein
STRINGMLOC_6041.12e-74(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP74203750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.15e-60myb domain protein 101
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]